PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_010326-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family WRKY
Protein Properties Length: 196aa    MW: 22164.2 Da    PI: 9.8078
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_010326-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.52.7e-33119177159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    ldDgy+WrKYGqK vk+s+fprsYYrCt+++C+vkk+v+r ++d+++v++tYeg Hnh+
  NNU_010326-RA 119 LDDGYRWRKYGQKAVKNSNFPRSYYRCTHHTCNVKKQVQRLSKDTSIVVTTYEGIHNHP 177
                    59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.806.0E-34105177IPR003657WRKY domain
SuperFamilySSF1182904.58E-29111178IPR003657WRKY domain
PROSITE profilePS5081128.736114179IPR003657WRKY domain
SMARTSM007746.9E-39119178IPR003657WRKY domain
PfamPF031061.7E-26120177IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
MEGEAPPLLP PLSSHNNPSY ILTPSLASTS LHPPLLYQPY NLLQGSNILP DIDWVSLLSS  60
PFGFGDLQKP LLSNADVTTR TGNKAEDEKS GKDKVKSSRM KKASRPRFAF QTRSTEDILD  120
DGYRWRKYGQ KAVKNSNFPR SYYRCTHHTC NVKKQVQRLS KDTSIVVTTY EGIHNHPCEK  180
LMESLSPLLK QIQFLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A8e-25109176774Probable WRKY transcription factor 4
2lex_A8e-25109176774Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00317DAPTransfer from AT2G46130Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010261390.11e-145PREDICTED: probable WRKY transcription factor 43
SwissprotQ8GY115e-56WRK43_ARATH; Probable WRKY transcription factor 43
TrEMBLA0A061DST45e-80A0A061DST4_THECC; WRKY DNA-binding protein 56
STRINGVIT_15s0046g02150.t011e-71(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46130.12e-57WRKY DNA-binding protein 43